IMPDH1 monoclonal antibody (M01), clone 3G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant IMPDH1.
Immunogen
IMPDH1 (NP_000874, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDC
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IMPDH1 monoclonal antibody (M01), clone 3G6 Western Blot analysis of IMPDH1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
IMPDH1 monoclonal antibody (M01), clone 3G6. Western Blot analysis of IMPDH1 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IMPDH1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — IMPDH1
Entrez GeneID
3614GeneBank Accession#
NM_000883Protein Accession#
NP_000874Gene Name
IMPDH1
Gene Alias
DKFZp781N0678, IMPD, IMPD1, LCA11, RP10, sWSS2608
Gene Description
IMP (inosine monophosphate) dehydrogenase 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene acts as a homotetramer to regulate cell growth. The encoded protein is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
inosine monophosphate dehydrogenase 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Novel direct targets of miR-19a identified in breast cancer cells by a quantitative proteomic approach.
Ouchida M, Kanzaki H, Ito S, Hanafusa H, Jitsumori Y, Tamaru S, Shimizu K.
PLoS One 2012 Aug; 7(8):e44095.
Application:WB, Human, MCF-7 cells.
-
Hydroxamic acid derivatives of mycophenolic acid inhibit histone deacetylase at the cellular level.
Batovska DI, Kim DH, Mitsuhashi S, Cho YS, Kwon HJ, Ubukata M.
Bioscience, Biotechnology, and Biochemistry 2008 Oct; 72(10):2623.
Application:WB-Ce, Human, K-562 cells.
-
Novel direct targets of miR-19a identified in breast cancer cells by a quantitative proteomic approach.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com