Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF9 monoclonal antibody (M01), clone 5F8

  • Catalog # : H00003604-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TNFRSF9.
  • Immunogen:
  • TNFRSF9 (AAH06196.1, 46 a.a. ~ 128 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDAAFGTFNDQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003604-M01
    Western Blot detection against Immunogen (11.33 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3604
  • Gene Name:
  • TNFRSF9
  • Gene Alias:
  • 4-1BB,CD137,CDw137,ILA,MGC2172
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 9
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB. [provided by RefSeq
  • Other Designations:
  • 4-1BB ligand receptor,CD137 antigen,OTTHUMP00000001360,OTTHUMP00000044294,T cell antigen ILA,homolog of mouse 4-1BB,induced by lymphocyte activation (ILA),interleukin-activated receptor, homolog of mouse Ly63,receptor protein 4-1BB
  • RSS
  • YouTube
  • Linkedin
  • Facebook