Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF9 (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00003604-H03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified TNFRSF9 (AAH06196.1 24 a.a. - 186 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293H cells
  • Sequence:
  • LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 23.21
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-TNFRSF9 plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    SDS-PAGE Gel
    QC Testing of H00003604-H03

    Western Blot
    QC Testing of H00003604-H03
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 3604
  • Gene Name:
  • TNFRSF9
  • Gene Alias:
  • 4-1BB,CD137,CDw137,ILA,MGC2172
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 9
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contributes to the clonal expansion, survival, and development of T cells. It can also induce proliferation in peripheral monocytes, enhance T cell apoptosis induced by TCR/CD3 triggered activation, and regulate CD28 co-stimulation to promote Th1 cell responses. The expression of this receptor is induced by lymphocyte activation. TRAF adaptor proteins have been shown to bind to this receptor and transduce the signals leading to activation of NF-kappaB. [provided by RefSeq
  • Other Designations:
  • 4-1BB ligand receptor,CD137 antigen,OTTHUMP00000001360,OTTHUMP00000044294,T cell antigen ILA,homolog of mouse 4-1BB,induced by lymphocyte activation (ILA),interleukin-activated receptor, homolog of mouse Ly63,receptor protein 4-1BB
  • RSS
  • YouTube
  • Linkedin
  • Facebook