Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL11 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003589-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL11 partial ORF ( NP_000632.1, 25 a.a. - 74 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.24
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003589-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3589
  • Gene Name:
  • IL11
  • Gene Alias:
  • AGIF,IL-11
  • Gene Description:
  • interleukin 11
  • Gene Summary:
  • The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. [provided by RefSeq
  • Other Designations:
  • adipogenesis inhibitory factor,oprelvekin
  • RSS
  • YouTube
  • Linkedin
  • Facebook