IL10RB (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human IL10RB partial ORF ( NP_000619, 20 a.a. - 119 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQ
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — IL10RB
Entrez GeneID
3588GeneBank Accession#
NM_000628Protein Accession#
NP_000619Gene Name
IL10RB
Gene Alias
CDW210B, CRF2-4, CRFB4, D21S58, D21S66, IL-10R2
Gene Description
interleukin 10 receptor, beta
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21. [provided by RefSeq
Other Designations
cytokine receptor class-II CRF2-4|cytokine receptor family II, member 4
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Evidence for non-neutralizing autoantibodies against IL-10 signalling components in patients with inflammatory bowel disease.
Frede N, Glocker EO, Wanders J, Engelhardt KR, Kreisel W, Ruemmele FM, Grimbacher B.
BMC Immunology 2014 Feb; 15(1):10.
Application:ELISA, Human, Serum.
-
Evidence for non-neutralizing autoantibodies against IL-10 signalling components in patients with inflammatory bowel disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com