IL7 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
IL7 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL7 expression in human kidney.
Western Blot (Tissue lysate)
IL7 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL7 expression in human placenta.
Western Blot (Transfected lysate)
Western Blot analysis of IL7 expression in transfected 293T cell line (H00003574-T01) by IL7 MaxPab polyclonal antibody.
Lane 1: IL7 transfected lysate(20.20 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human IL7 protein.
Immunogen
IL7 (AAH47698.1, 1 a.a. ~ 177 a.a) full-length human protein.
Sequence
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
IL7 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL7 expression in human kidney.Western Blot (Tissue lysate)
IL7 MaxPab rabbit polyclonal antibody. Western Blot analysis of IL7 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of IL7 expression in transfected 293T cell line (H00003574-T01) by IL7 MaxPab polyclonal antibody.
Lane 1: IL7 transfected lysate(20.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — IL7
Entrez GeneID
3574GeneBank Accession#
NM_000880Protein Accession#
AAH47698.1Gene Name
IL7
Gene Alias
IL-7
Gene Description
interleukin 7
Omim ID
146660Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. This cytokine is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. Knockout studies in mice suggested that this cytokine plays an essential role in lymphoid cell survival. [provided by RefSeq
Other Designations
IL7 nirs variant 6
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com