Product Browser

Last updated: 2017/6/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Scientific Image Contest
pathway

IL6ST (Human) Recombinant Protein (Q01)

  • Catalog # : H00003572-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL6ST partial ORF ( NP_002175, 23 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003572-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3572
  • Gene Name:
  • IL6ST
  • Gene Alias:
  • CD130,CDw130,GP130,GP130-RAPS,IL6R-beta
  • Gene Description:
  • interleukin 6 signal transducer (gp130, oncostatin M receptor)
  • Gene Summary:
  • The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggested a critical role of the gene encoding this protein in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
  • Other Designations:
  • CD130 antigen,IL6ST nirs variant 3,OTTHUMP00000122545,gp130 of the rheumatoid arthritis antigenic peptide-bearing soluble form,gp130 transducer chain,interleukin 6 signal transducer,interleukin receptor beta chain,membrane glycoprotein gp130,oncostatin M
  • RSS
  • YouTube
  • Linkedin
  • Facebook