IL6ST monoclonal antibody (M02), clone 4A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant IL6ST.
Immunogen
IL6ST (NP_002175, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (68); Rat (73)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IL6ST monoclonal antibody (M02), clone 4A4. Western Blot analysis of IL6ST expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IL6ST is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — IL6ST
Entrez GeneID
3572GeneBank Accession#
NM_002184Protein Accession#
NP_002175Gene Name
IL6ST
Gene Alias
CD130, CDw130, GP130, GP130-RAPS, IL6R-beta
Gene Description
interleukin 6 signal transducer (gp130, oncostatin M receptor)
Omim ID
600694Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggested a critical role of the gene encoding this protein in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
CD130 antigen|IL6ST nirs variant 3|OTTHUMP00000122545|gp130 of the rheumatoid arthritis antigenic peptide-bearing soluble form|gp130 transducer chain|interleukin 6 signal transducer|interleukin receptor beta chain|membrane glycoprotein gp130|oncostatin M
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com