IL6R purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human IL6R protein.
Immunogen
IL6R (NP_000556.1, 1 a.a. ~ 468 a.a) full-length human protein.
Sequence
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Flow Cytometry
FACS analysis of negative control 293 cells (Black) and IL6R expressing 293 cells (Green) using IL6R purified MaxPab mouse polyclonal antibody.Western Blot (Cell lysate)
IL6R MaxPab polyclonal antibody. Western Blot analysis of IL6R expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of IL6R expression in transfected 293T cell line (H00003570-T01) by IL6R MaxPab polyclonal antibody.
Lane 1: IL6R transfected lysate(51.48 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — IL6R
Entrez GeneID
3570GeneBank Accession#
NM_000565Protein Accession#
NP_000556.1Gene Name
IL6R
Gene Alias
CD126, IL-6R-1, IL-6R-alpha, IL6RA, MGC104991
Gene Description
interleukin 6 receptor
Omim ID
147880Gene Ontology
HyperlinkGene Summary
Interleukin 6 (IL6) is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in immune response. The protein encoded by this gene is a subunit of the receptor complex for IL6. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
CD126 antigen|OTTHUMP00000034320|interleukin 6 receptor alpha subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com