IL4R purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human IL4R protein.
Immunogen
IL4R (NP_001008699.1, 1 a.a. ~ 227 a.a) full-length human protein.
Sequence
MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSNIC
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Flow Cytometry
FACS analysis of negative control 293 cells (Black) and IL4R expressing 293 cells (Green) using IL4R purified MaxPab mouse polyclonal antibody.Western Blot (Transfected lysate)
Western Blot analysis of IL4R expression in transfected 293T cell line (H00003566-T02) by IL4R MaxPab polyclonal antibody.
Lane 1: IL4R transfected lysate(24.97 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — IL4R
Entrez GeneID
3566GeneBank Accession#
NM_001008699Protein Accession#
NP_001008699.1Gene Name
IL4R
Gene Alias
CD124, IL4RA
Gene Description
interleukin 4 receptor
Gene Ontology
HyperlinkGene Summary
This gene encodes the alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by an alternate splice variant or by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. Allelic variations in this gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema. Two transcript variants encoding different isoforms, a membrane-bound and a soluble form, have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000122506|interleukin 4 receptor alpha chain|interleukin-4 receptor alpha chain
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com