IL1RN monoclonal antibody (M03), clone 1H5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant IL1RN.
Immunogen
IL1RN (AAH09745, 1 a.a. ~ 159 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (76); Rat (74)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43.23 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of IL1RN expression in transfected 293T cell line by IL1RN monoclonal antibody (M03), clone 1H5.
Lane 1: IL1RN transfected lysate(20.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of IL1RN transfected lysate using anti-IL1RN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL1RN MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IL1RN is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — IL1RN
Entrez GeneID
3557GeneBank Accession#
BC009745Protein Accession#
AAH09745Gene Name
IL1RN
Gene Alias
ICIL-1RA, IL-1ra3, IL1F3, IL1RA, IRAP, MGC10430
Gene Description
interleukin 1 receptor antagonist
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
IL1RN (IL1F3)|intracellular IL-1 receptor antagonist type II|intracellular interleukin-1 receptor antagonist (icIL-1ra)|type II interleukin-1 receptor antagonist
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com