Product Browser

Last updated: 2017/10/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL1RN MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00003557-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human IL1RN protein.
  • Immunogen:
  • IL1RN (NP_776214.1, 1 a.a. ~ 177 a.a) full-length human protein.
  • Sequence:
  • MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of IL1RN expression in transfected 293T cell line (H00003557-T02) by IL1RN MaxPab polyclonal antibody.

    Lane 1: IL1RN transfected lysate(20.10 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3557
  • Gene Name:
  • IL1RN
  • Gene Alias:
  • ICIL-1RA,IL-1ra3,IL1F3,IL1RA,IRAP,MGC10430
  • Gene Description:
  • interleukin 1 receptor antagonist
  • Gene Summary:
  • The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Four alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • IL1RN (IL1F3),intracellular IL-1 receptor antagonist type II,intracellular interleukin-1 receptor antagonist (icIL-1ra),type II interleukin-1 receptor antagonist
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook