IKBKB purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human IKBKB protein.
Immunogen
IKBKB (AAH06231.1, 1 a.a. ~ 256 a.a) full-length human protein.
Sequence
MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVAHSCNPSTLGGRGRWIS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
IKBKB MaxPab polyclonal antibody. Western Blot analysis of IKBKB expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of IKBKB expression in transfected 293T cell line (H00003551-T01) by IKBKB MaxPab polyclonal antibody.
Lane 1: IKBKB transfected lysate(28.16 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — IKBKB
Entrez GeneID
3551GeneBank Accession#
BC006231.2Protein Accession#
AAH06231.1Gene Name
IKBKB
Gene Alias
FLJ40509, IKK-beta, IKK2, IKKB, MGC131801, NFKBIKB
Gene Description
inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
Omim ID
603258Gene Ontology
HyperlinkGene Summary
NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB, MIM 604495), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM
Other Designations
inhibitor of nuclear factor kappa B kinase beta subunit|nuclear factor NF-kappa-B inhibitor kinase beta
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com