Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IHH monoclonal antibody (M01), clone 2G9

  • Catalog # : H00003549-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant IHH.
  • Immunogen:
  • IHH (AAH34757, 119 a.a. ~ 217 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • ESGARVALSAVRPGDRVLAMGEDGSPTFSDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQPGQYVLVAGVPG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • 1.
  • Protease nexin 1 inhibits hedgehog signaling in prostate adenocarcinoma.
    McKee CM, Xu D, Cao Y, Kabraji S, Allen D, Kersemans V, Beech J, Smart S, Hamdy F, Ishkanian A, Sykes J, Pintile M, Milosevic M, van der Kwast T, Zafarana G, Ramnarine VR, Jurisica I, Mallof C, Lam W, Bristow RG, Muschel RJ.J Clin Invest. 2012 Nov 1;122(11):4025-36. doi: 10.1172/JCI59348. Epub 2012 Oct 8.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • IHH monoclonal antibody (M01), clone 2G9 Western Blot analysis of IHH expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3549
  • Gene Name:
  • IHH
  • Gene Alias:
  • BDA1,HHG2
  • Gene Description:
  • Indian hedgehog homolog (Drosophila)
  • Other Designations:
  • Indian hedgehog homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook