Product Browser

Last updated: 2017/3/26
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGSF1 monoclonal antibody (M01), clone 4C7

  • Catalog # : H00003547-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant IGSF1.
  • Immunogen:
  • IGSF1 (NP_001546, 220 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • VVAGLYPKPTLTAHPGPIMAPGESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFQSLKIQDTGHYLCFYYDASYRGSLLSD
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003547-M01
    Western Blot detection against Immunogen (35.75 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • IGSF1 monoclonal antibody (M01), clone 4C7. Western Blot analysis of IGSF1 expression in rat brain.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • IGSF1 monoclonal antibody (M01), clone 4C7. Western Blot analysis of IGSF1 expression in HeLa.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3547
  • Gene Name:
  • IGSF1
  • Gene Alias:
  • IGCD1,IGDC1,INHBP,KIAA0364,MGC75490,PGSF2
  • Gene Description:
  • immunoglobulin superfamily, member 1
  • Gene Summary:
  • Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000024029,OTTHUMP00000024030,OTTHUMP00000024031,immunoglobulin-like domain-containing 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook