IGHG1 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human IGHG1 protein.
Immunogen
IGHG1 (AAH92518.1, 1 a.a. ~ 469 a.a) full-length human protein.
Sequence
MEFGLSWVFLVAILKGVQCEVQLVESGGVVVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRAEDTALYYCATRGGYSTAGFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of IGHG1 expression in transfected 293T cell line (H00003500-T02) by IGHG1 MaxPab polyclonal antibody.
Lane 1: IGHG1 transfected lysate(51.30 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of IGHG1 transfected lysate using anti-IGHG1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with IGHG1 purified MaxPab mouse polyclonal antibody (B01P) (H00003500-B01P).Immunofluorescence
Immunofluorescence of purified MaxPab antibody to IGHG1 on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — IGHG1
Entrez GeneID
3500GeneBank Accession#
BC092518Protein Accession#
AAH92518.1Gene Name
IGHG1
Gene Alias
-
Gene Description
immunoglobulin heavy constant gamma 1 (G1m marker)
Omim ID
147100Gene Ontology
HyperlinkOther Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
Silencing of IGHG1 reverses the resistance of pancreatic cancer to multidrug chemotherapy by modulating autophagy.
Yuan Tian, Wenwen Han, Long Fu, Kaiji Lv, Xinhua Zhou.
Environmental Toxicology 2023 Aug; 38(8):1835.
Application:WB, Human, Human pancrease.
-
Using anti-malondialdehyde-modified peptide adduct autoantibodies in serum of taiwanese women to diagnose primary Sjogren's syndrome.
Yuarn-Jang Lee, Ying-Chin Lin, Chen-Chung Liao, Yu-Sheng Chang, Yu-Hui Huang, I-Jung Tsai, Jin-Hua Chen, Sheng-Hong Lin, Yi-Fang Lin, Ting-Wan Hsieh, Yi-Su Chen, Chih-Yin Wu, Chi-Ching Chang, Ching-Yu Lin.
Clinical Biochemistry 2022 Oct; 108:27.
Application:IP, WB-Ce, Human, Human serum.
-
Proteomic Investigation of Malignant Major Salivary Gland Tumors.
Seccia V, Navari E, Donadio E, Boldrini C, Ciregia F, Ronci M, Aceto A, Dallan I, Lucacchini A, Casani AP, Mazzoni MR, Giusti .
Head and Neck Pathology 2019 May; [Epub].
Application:WB-Ti, Human, Human salivary gland tumors.
-
New insight into benign tumours of major salivary glands by proteomic approach.
Donadio E, Giusti L, Seccia V, Ciregia F, da Valle Y, Dallan I, Ventroni T, Giannaccini G, Sellari-Franceschini S, Lucacchini A.
PLoS One 2013 Aug; 8(8):e71874.
Application:WB-Ti, Human, Pleomorphic adenomas, Fine needle aspiration.
-
Silencing of IGHG1 reverses the resistance of pancreatic cancer to multidrug chemotherapy by modulating autophagy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com