Product Browser

Last updated: 2022/5/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGFBP1 DNAxPab DNAxPab

  • Catalog # : H00003484-W01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human IGFBP1 DNA using DNAx™ Immune technology.
  • Immunogen:
  • IGFBP1 (AAH35263.2, 26 a.a. ~ 259 a.a) partial-length human DNA
  • Sequence:
  • MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQMYFNVQN
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Purification:
  • Protein A
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of IGFBP1 expression in transfected 293T cell line by IGFBP1 DNAxPab polyclonal antibody.

    Lane 1: IGFBP1 transfected lysate(46.86 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Gene Information
  • Entrez GeneID:
  • 3484
  • Gene Name:
  • IGFBP1
  • Gene Alias:
  • AFBP,IBP1,IGF-BP25,PP12,hIGFBP-1
  • Gene Description:
  • insulin-like growth factor binding protein 1
  • Gene Summary:
  • This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. [provided by RefSeq
  • Other Designations:
  • IGF-binding protein 1,alpha-pregnancy-associated endometrial globulin,amniotic fluid binding protein,binding protein-25,binding protein-26,binding protein-28,growth hormone independent-binding protein,placental protein 12
  • RSS
  • YouTube
  • Linkedin
  • Facebook