Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGFBP1 monoclonal antibody (M01), clone 2F9

  • Catalog # : H00003484-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant IGFBP1.
  • Immunogen:
  • IGFBP1 (NP_000587, 160 a.a. ~ 259 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • GSKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIPGSPEIRGDPNCQIYFNVQN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003484-M01
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of IGFBP1 expression in transfected 293T cell line by IGFBP1 monoclonal antibody (M01), clone 2F9.

    Lane 1: IGFBP1 transfected lysate (Predicted MW: 27.9 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3484
  • Gene Name:
  • IGFBP1
  • Gene Alias:
  • AFBP,IBP1,IGF-BP25,PP12,hIGFBP-1
  • Gene Description:
  • insulin-like growth factor binding protein 1
  • Gene Summary:
  • This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. [provided by RefSeq
  • Other Designations:
  • IGF-binding protein 1,alpha-pregnancy-associated endometrial globulin,amniotic fluid binding protein,binding protein-25,binding protein-26,binding protein-28,growth hormone independent-binding protein,placental protein 12
  • RSS
  • YouTube
  • Linkedin
  • Facebook