Product Browser

Last updated: 2017/3/26
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGF2R polyclonal antibody (A01)

  • Catalog # : H00003482-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant IGF2R.
  • Immunogen:
  • IGF2R (NP_000867, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GTNHRVQSSIAFLCGKTLGTPEFVTATECVHYFEWRTTAACKKDIFKANKEVPCYVFDEELRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3482
  • Gene Name:
  • IGF2R
  • Gene Alias:
  • CD222,CIMPR,M6P-R,MPR1,MPRI
  • Gene Description:
  • insulin-like growth factor 2 receptor
  • Gene Summary:
  • The protein encoded by this gene is a receptor for both, insulin-like growth factor 2 (IGF2) and mannose 6-phosphate (M6P). The IGF2 and M6P binding sites are located on different segments of the receptor. This receptor functions in the intracellular trafficking of lysosomal enzymes, the activation of transforming growth factor beta, and the degradation of IGF2. In mice, the homologous gene is expressed only from the maternal chromosome. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017536,cation-independent mannose-6 phosphate receptor,insulin-like growth factor-2 receptor (mannose-6-phosphate receptor, cation-independent)
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook