IGF2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human IGF2 partial ORF ( NP_000603, 25 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.64
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — IGF2
Entrez GeneID
3481GeneBank Accession#
NM_000612Protein Accession#
NP_000603Gene Name
IGF2
Gene Alias
C11orf43, FLJ22066, FLJ44734, INSIGF, pp9974
Gene Description
insulin-like growth factor 2 (somatomedin A)
Omim ID
147470Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the insulin family of polypeptide growth factors that is involved in development and growth. It is an imprinted gene and is expressed only from the paternally inherited allele. It is a candidate gene for eating disorders. There is a read-through, INS-IGF2, which aligns to this gene at the 3' region and to the upstream INS gene at the 5' region. Alternatively spliced transcript variants, encoding either the same or different isoform, have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000011012|OTTHUMP00000011015|OTTHUMP00000011018|OTTHUMP00000011157|insulin-like growth factor 2|insulin-like growth factor II|insulin-like growth factor type 2|putative insulin-like growth factor II associated protein|somatomedin A
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com