Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGF1R (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00003480-H01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified IGF1R (NP_000866.1 741 a.a. - 935 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293H cells
  • Sequence:
  • DVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIH
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 24.53
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-IGF1R plasmid into HEK293H cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    SDS-PAGE Gel
    QC Testing of H00003480-H01

    Western Blot
    QC Testing of H00003480-H01
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 3480
  • Gene Name:
  • IGF1R
  • Gene Alias:
  • CD221,IGFIR,JTK13,MGC142170,MGC142172,MGC18216
  • Gene Description:
  • insulin-like growth factor 1 receptor
  • Gene Summary:
  • This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. [provided by RefSeq
  • Other Designations:
  • soluble IGF1R variant 1,soluble IGF1R variant 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook