Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGF1R polyclonal antibody (A01)

  • Catalog # : H00003480-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant IGF1R.
  • Immunogen:
  • IGF1R (NP_000866, 761 a.a. ~ 870 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3480
  • Gene Name:
  • IGF1R
  • Gene Alias:
  • CD221,IGFIR,JTK13,MGC142170,MGC142172,MGC18216
  • Gene Description:
  • insulin-like growth factor 1 receptor
  • Gene Summary:
  • This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. [provided by RefSeq
  • Other Designations:
  • soluble IGF1R variant 1,soluble IGF1R variant 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook