Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGBP1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003476-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IGBP1 partial ORF ( NP_001542, 64 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQRYKQK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.96
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003476-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3476
  • Gene Name:
  • IGBP1
  • Gene Alias:
  • ALPHA-4,IBP1
  • Gene Description:
  • immunoglobulin (CD79A) binding protein 1
  • Gene Summary:
  • The proliferation and differentiation of B cells is dependent upon a B-cell antigen receptor (BCR) complex. Binding of antigens to specific B-cell receptors results in a tyrosine phosphorylation reaction through the BCR complex and leads to multiple signal transduction pathways. [provided by RefSeq
  • Other Designations:
  • B cell signal transduction molecule alpha 4,OTTHUMP00000023464,OTTHUMP00000023465,alpha 4,bA351K23.1 (immunoglobulin binding protein 1 (CD79A) ),immunoglobulin binding protein 1,immunoglobulin-binding protein 1,protein phosphatase 2A, regulatory subunit a
  • RSS
  • YouTube
  • Linkedin
  • Facebook