Product Browser

Last updated: 2016/12/11
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IGBP1 monoclonal antibody (M01), clone 2B8

  • Catalog # : H00003476-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant IGBP1.
  • Immunogen:
  • IGBP1 (NP_001542, 64 a.a. ~ 165 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • RNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYHVAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQRYKQK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3476
  • Gene Name:
  • IGBP1
  • Gene Alias:
  • ALPHA-4,IBP1
  • Gene Description:
  • immunoglobulin (CD79A) binding protein 1
  • Gene Summary:
  • The proliferation and differentiation of B cells is dependent upon a B-cell antigen receptor (BCR) complex. Binding of antigens to specific B-cell receptors results in a tyrosine phosphorylation reaction through the BCR complex and leads to multiple signal transduction pathways. [provided by RefSeq
  • Other Designations:
  • B cell signal transduction molecule alpha 4,OTTHUMP00000023464,OTTHUMP00000023465,alpha 4,bA351K23.1 (immunoglobulin binding protein 1 (CD79A) ),immunoglobulin binding protein 1,immunoglobulin-binding protein 1,protein phosphatase 2A, regulatory subunit a
  • RSS
  • YouTube
  • Linkedin
  • Facebook