Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IFNAR2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003455-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IFNAR2 partial ORF ( NP_997468.1, 144 a.a. - 243 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • FTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKGNMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESESAESAK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003455-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3455
  • Gene Name:
  • IFNAR2
  • Gene Alias:
  • IFN-R,IFN-alpha-REC,IFNABR,IFNARB
  • Gene Description:
  • interferon (alpha, beta and omega) receptor 2
  • Gene Summary:
  • The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. Multiple transcript variants encoding at least two different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000067674,OTTHUMP00000067676,human interferon alpha/beta receptor,interferon alpha/beta receptor 2,interferon-alpha/beta receptor beta chain,type I interferon receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook