IFI35 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human IFI35 protein.
Immunogen
IFI35 (NP_005524.1, 1 a.a. ~ 288 a.a) full-length human protein.
Sequence
MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESG
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IFI35 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFI35 expression in A-431.Western Blot (Cell lysate)
IFI35 MaxPab rabbit polyclonal antibody. Western Blot analysis of IFI35 expression in Raw 264.7.Western Blot (Transfected lysate)
Western Blot analysis of IFI35 expression in transfected 293T cell line (H00003430-T01) by IFI35 MaxPab polyclonal antibody.
Lane 1: IFI35 transfected lysate(31.70 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to IFI35 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — IFI35
Entrez GeneID
3430GeneBank Accession#
NM_005533.2Protein Accession#
NP_005524.1Gene Name
IFI35
Gene Alias
FLJ21753, IFP35
Gene Description
interferon-induced protein 35
Omim ID
600735Gene Ontology
HyperlinkOther Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
IFP35 aggravates Staphylococcus aureus infection by promoting Nrf2-regulated ferroptosis.
Min Dai, Wei Ouyang, Yangle Yu, Tao Wang, Yanling Wang, Mengyuan Cen, Liping Yang, Yu Han, Yushi Yao, Feng Xu.
Journal of Advanced Research 2023 Sep; S2090-1232(23):291.
Application:WB, Mouse, BMDM.
-
The danger signal interferon-induced protein 35 (IFP35) mediates acetaminophen-induced liver injury.
Xiating Mao, Danning Wu, Na Xu, Jingjing Wang, Jinhua Zeng, Zhiqiang Jiang, Yingfang Liu, Huanhuan Liang.
Biochemical and Biophysical Research Communications 2022 Jul; 621:25.
Application:IHC-P, WB-Ce, Mouse, HepG2 cells, Mouse liver.
-
IFP35 aggravates Staphylococcus aureus infection by promoting Nrf2-regulated ferroptosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com