IFI16 monoclonal antibody (M03), clone 2E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant IFI16.
Immunogen
IFI16 (AAH17059, 630 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (43)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
IFI16 monoclonal antibody (M03), clone 2E3. Western Blot analysis of IFI16 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of IFI16 expression in transfected 293T cell line by IFI16 monoclonal antibody (M03), clone 2E3.
Lane 1: IFI16 transfected lysate(82 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to IFI16 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IFI16 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to IFI16 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — IFI16
Entrez GeneID
3428GeneBank Accession#
BC017059Protein Accession#
AAH17059Gene Name
IFI16
Gene Alias
IFNGIP1, MGC9466, PYHIN2
Gene Description
interferon, gamma-inducible protein 16
Omim ID
147586Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the HIN-200 (hematopoietic interferon-inducible nuclear antigens with 200 amino acid repeats) family of cytokines. The encoded protein contains domains involved in DNA binding, transcriptional regulation, and protein-protein interactions. The protein localizes to the nucleoplasm and nucleoli, and interacts with p53 and retinoblastoma-1. It modulates p53 function, and inhibits cell growth in the Ras/Raf signaling pathway. [provided by RefSeq
Other Designations
OTTHUMP00000035192|interferon-gamma induced protein IFI 16|interferon-inducible myeloid differentiation transcriptional activator
-
Interactome
-
Disease
-
Publication Reference
-
The significance of interferon gamma inducible protein 16 (IFI16) expression in drug resistant ovarian cancer cell lines.
Justyna Borucka, Karolina Sterzyńska, Dominika Kaźmierczak, Monika Świerczewska, Marta Nowacka, Karolina Wojtowicz, Andrzej Klejewski, Michał Nowicki, Maciej Zabel, Rodryg Ramlau, Radosław Januchowski.
Biomedicine & Pharmacotherapy 2022 Apr; 150:113036.
Application:IF, Human, A2780 cells.
-
The significance of interferon gamma inducible protein 16 (IFI16) expression in drug resistant ovarian cancer cell lines.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com