Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IDI1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003422-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IDI1 partial ORF ( NP_004499, 175 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • IPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003422-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3422
  • Gene Name:
  • IDI1
  • Gene Alias:
  • IPP1,IPPI1
  • Gene Description:
  • isopentenyl-diphosphate delta isomerase 1
  • Gene Summary:
  • IDI1 encodes a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity. [provided by RefSeq
  • Other Designations:
  • IPP isomerase,OTTHUMP00000018951,isopentenyl diphosphate dimethylallyl diphosphate isomerase 1,isopentenyl pyrophosphate isomerase 1,isopentenyl-diphosphate delta isomerase
  • RSS
  • YouTube
  • Linkedin
  • Facebook