Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IDI1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00003422-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human IDI1 protein.
  • Immunogen:
  • IDI1 (AAH57827.1, 1 a.a. ~ 228 a.a) full-length human protein.
  • Sequence:
  • MMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of IDI1 expression in transfected 293T cell line (H00003422-T01) by IDI1 MaxPab polyclonal antibody.

    Lane 1: IDI1 transfected lysate(25.08 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3422
  • Gene Name:
  • IDI1
  • Gene Alias:
  • IPP1,IPPI1
  • Gene Description:
  • isopentenyl-diphosphate delta isomerase 1
  • Gene Summary:
  • IDI1 encodes a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity. [provided by RefSeq
  • Other Designations:
  • IPP isomerase,OTTHUMP00000018951,isopentenyl diphosphate dimethylallyl diphosphate isomerase 1,isopentenyl pyrophosphate isomerase 1,isopentenyl-diphosphate delta isomerase
  • RSS
  • YouTube
  • Linkedin
  • Facebook