IDH3B monoclonal antibody (M01), clone 3A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant IDH3B.
Immunogen
IDH3B (NP_008830, 296 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YSAEYAVFETGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (97)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
ELISA
-
Gene Info — IDH3B
Entrez GeneID
3420GeneBank Accession#
NM_006899Protein Accession#
NP_008830Gene Name
IDH3B
Gene Alias
FLJ11043, H-IDHB, MGC903
Gene Description
isocitrate dehydrogenase 3 (NAD+) beta
Omim ID
604526Gene Ontology
HyperlinkGene Summary
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. Three alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Other Designations
NAD+-specific ICDH|NAD+-specific isocitrate dehydrogenase b subunit|NAD+-specific isocitrate dehydrogenase beta|OTTHUMP00000030023|OTTHUMP00000030024|isocitrate dehydrogenase 3, beta subunit|isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, beta s
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Metabolic pathways
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com