Product Browser

Last updated: 2017/8/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IDE polyclonal antibody (A01)

  • Catalog # : H00003416-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant IDE.
  • Immunogen:
  • IDE (NP_004960, 920 a.a. ~ 1019 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • RDNTEVAYLKTLTKEDIIKFYKEMLAVDAPRRHKVSVHVLAREMDSCPVVGEFPCQNDINLSQAPALPQPEVIQNMTEFKRGLPLFPLVKPHINFMAAKL
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003416-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • IDE polyclonal antibody (A01), Lot # ABNOVA060711QCS1. Western Blot analysis of IDE expression in PC-12.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • IDE polyclonal antibody (A01), Lot # ABNOVA060711QCS1 Western Blot analysis of IDE expression in K-562 ( Cat # L009V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3416
  • Gene Name:
  • IDE
  • Gene Alias:
  • FLJ35968,INSULYSIN
  • Gene Description:
  • insulin-degrading enzyme
  • Gene Summary:
  • This gene may belong to a protease family responsible for intercellular peptide signalling. Though its role in the cellular processing of insulin has not yet been defined, insulin-degrading enzyme is thought to be involved in the termination of the insulin response. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000020097,insulinase,insulysin
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook