ID4 monoclonal antibody (M13), clone 3F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ID4 expression in transfected 293T cell line by ID4 monoclonal antibody (M13), clone 3F11.
Lane 1: ID4 transfected lysate (Predicted MW: 16.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ID4 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (43 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant ID4.
Immunogen
ID4 (NP_001537.1, 1 a.a. ~ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (43 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ID4 expression in transfected 293T cell line by ID4 monoclonal antibody (M13), clone 3F11.
Lane 1: ID4 transfected lysate (Predicted MW: 16.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ID4 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — ID4
Entrez GeneID
3400GeneBank Accession#
NM_001546.2Protein Accession#
NP_001537.1Gene Name
ID4
Gene Alias
IDB4, bHLHb27
Gene Description
inhibitor of DNA binding 4, dominant negative helix-loop-helix protein
Omim ID
600581Gene Ontology
HyperlinkGene Summary
Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al., 1995 [PubMed 7665172]).[supplied by OMIM
Other Designations
OTTHUMP00000016081
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com