ID4 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ID4 expression in transfected 293T cell line (H00003400-T02) by ID4 MaxPab polyclonal antibody.
Lane 1: ID4 transfected lysate(17.71 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ID4 protein.
Immunogen
ID4 (NP_001537, 1 a.a. ~ 161 a.a) full-length human protein.
Sequence
MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ID4 expression in transfected 293T cell line (H00003400-T02) by ID4 MaxPab polyclonal antibody.
Lane 1: ID4 transfected lysate(17.71 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ID4
Entrez GeneID
3400GeneBank Accession#
NM_001546Protein Accession#
NP_001537Gene Name
ID4
Gene Alias
IDB4, bHLHb27
Gene Description
inhibitor of DNA binding 4, dominant negative helix-loop-helix protein
Omim ID
600581Gene Ontology
HyperlinkGene Summary
Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al., 1995 [PubMed 7665172]).[supplied by OMIM
Other Designations
OTTHUMP00000016081
-
Interactome
-
Pathway
-
Publication Reference
-
In Vitro Derivation and Propagation of Spermatogonial Stem Cell Activity from Mouse Pluripotent Stem Cells.
Ishikura Y, Yabuta Y, Ohta H, Hayashi K, Nakamura T, Okamoto I, Yamamoto T, Kurimoto K, Shirane K, Sasaki H, Saitou M.
Cell Reports 2016 Dec; 17(10):2789.
Application：IF, Mouse, Mouse testes with transplanted cells.
-
Inhibitor of DNA binding 4 is expressed selectively by single spermatogonia in the male germline and regulates the self-renewal of spermatogonial stem cells in mice.
Oatley MJ, Kaucher AV, Racicot KE, Oatley JM.
Biology of Reproduction 2011 Aug; 85(2):347.
Application：IF, Mouse, Testes.
-
In Vitro Derivation and Propagation of Spermatogonial Stem Cell Activity from Mouse Pluripotent Stem Cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com