ID2 monoclonal antibody (M04), clone 2C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ID2.
Immunogen
ID2 (AAH30639, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (40.48 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ID2 monoclonal antibody (M04), clone 2C11 Western Blot analysis of ID2 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
ID2 monoclonal antibody (M04), clone 2C11. Western Blot analysis of ID2 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ID2 expression in transfected 293T cell line by ID2 monoclonal antibody (M04), clone 2C11.
Lane 1: ID2 transfected lysate(14.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — ID2
Entrez GeneID
3398GeneBank Accession#
BC030639Protein Accession#
AAH30639Gene Name
ID2
Gene Alias
GIG8, ID2A, ID2H, MGC26389, bHLHb26
Gene Description
inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
Omim ID
600386Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. [provided by RefSeq
Other Designations
DNA-binding protein inhibitor ID2|OTTHUMP00000140258|cell growth-inhibiting gene 8|helix-loop-helix protein ID2|inhibitor of DNA binding 2|inhibitor of differentiation 2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The Transcriptional Repressor ID2 Can Interact with the Canonical Clock Components CLOCK and BMAL1 and Mediate Inhibitory Effects on mPer1 Expression.
Ward SM, Fernando SJ, Hou TY, Duffield GE.
The Journal of Biological Chemistry 2010 Dec; 285(50):38987.
Application:WB-Tr, Mouse, NIH3T3 cells.
-
The Transcriptional Repressor ID2 Can Interact with the Canonical Clock Components CLOCK and BMAL1 and Mediate Inhibitory Effects on mPer1 Expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com