Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ID2 polyclonal antibody (A02)

  • Catalog # : H00003398-A02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ID2.
  • Immunogen:
  • ID2 (NP_002157, 1 a.a. ~ 67 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3398
  • Gene Name:
  • ID2
  • Gene Alias:
  • GIG8,ID2A,ID2H,MGC26389,bHLHb26
  • Gene Description:
  • inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
  • Gene Summary:
  • The protein encoded by this gene belongs to the inhibitor of DNA binding (ID) family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the ID family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene has been identified for this gene. [provided by RefSeq
  • Other Designations:
  • DNA-binding protein inhibitor ID2,OTTHUMP00000140258,cell growth-inhibiting gene 8,helix-loop-helix protein ID2,inhibitor of DNA binding 2,inhibitor of differentiation 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook