Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ID1 (Human) Recombinant Protein (P01)

  • Catalog # : H00003397-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ID1 full-length ORF ( AAH00613.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.79
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003397-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3397
  • Gene Name:
  • ID1
  • Gene Alias:
  • ID,bHLHb24
  • Gene Description:
  • inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
  • Gene Summary:
  • The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • DNA-binding protein inhibitor ID-1,OTTHUMP00000030534,OTTHUMP00000030535,dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein),inhibitor of DNA binding 1,inhibitor of differentiation 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook