ID1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ID1 full-length ORF ( AAH00613.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
42.79
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ID1
Entrez GeneID
3397GeneBank Accession#
BC000613Protein Accession#
AAH00613.1Gene Name
ID1
Gene Alias
ID, bHLHb24
Gene Description
inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Omim ID
600349Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
DNA-binding protein inhibitor ID-1|OTTHUMP00000030534|OTTHUMP00000030535|dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein)|inhibitor of DNA binding 1|inhibitor of differentiation 1
-
Interactome
-
Pathway
-
Publication Reference
-
Inflammatory properties of inhibitor of DNA binding 1 secreted by synovial fibroblasts in rheumatoid arthritis.
Edhayan G, Ohara RA, Stinson WA, Amin MA, Isozaki T, Ha CM, Haines GK 3rd, Morgan R, Campbell PL, Arbab AS, Friday SC, Fox DA, Ruth JH.
Arthritis Research & Therapy 2016 Apr; 18(1):87.
Application：Incubated, Recombinant protein.
-
Inflammatory properties of inhibitor of DNA binding 1 secreted by synovial fibroblasts in rheumatoid arthritis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com