ID1 monoclonal antibody (M03), clone 2E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ID1.
Immunogen
ID1 (AAH00613.1, 1 a.a. ~ 155 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.79 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ID1 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — ID1
Entrez GeneID
3397GeneBank Accession#
BC000613Protein Accession#
AAH00613.1Gene Name
ID1
Gene Alias
ID, bHLHb24
Gene Description
inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Omim ID
600349Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
DNA-binding protein inhibitor ID-1|OTTHUMP00000030534|OTTHUMP00000030535|dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein)|inhibitor of DNA binding 1|inhibitor of differentiation 1
-
Interactome
-
Pathway
-
Publication Reference
-
Increased expression of Id1 and Id3 promotes tumorigenicity by enhancing angiogenesis and suppressing apoptosis in small cell lung cancer.
Chen D, Forootan SS, Gosney JR, Forootan FS, Ke Y.
Genes & Cancer 2014 May; 5(5-6):212.
Application:WB-Tr, Human, N417 cells.
-
Increased expression of Id1 and Id3 promotes tumorigenicity by enhancing angiogenesis and suppressing apoptosis in small cell lung cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com