ID1 monoclonal antibody (M02), clone 1F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ID1.
Immunogen
ID1 (AAH00613.1, 1 a.a. ~ 155 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (42.79 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ID1 expression in transfected 293T cell line by ID1 monoclonal antibody (M02), clone 1F7.
Lane 1: ID1 transfected lysate(16.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ID1 is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of ID1 over-expressed 293 cell line, cotransfected with ID1 Validated Chimera RNAi ( Cat # H00003397-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with ID1 monoclonal antibody (M02), clone 1F7 (Cat # H00003397-M02 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to ID1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — ID1
Entrez GeneID
3397GeneBank Accession#
BC000613Protein Accession#
AAH00613.1Gene Name
ID1
Gene Alias
ID, bHLHb24
Gene Description
inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
Omim ID
600349Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
DNA-binding protein inhibitor ID-1|OTTHUMP00000030534|OTTHUMP00000030535|dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein)|inhibitor of DNA binding 1|inhibitor of differentiation 1
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com