Product Browser

Last updated: 2017/11/19
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Biomarker

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ID1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00003397-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human ID1 protein.
  • Immunogen:
  • ID1 (NP_002156.2, 1 a.a. ~ 155 a.a) full-length human protein.
  • Sequence:
  • MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of ID1 expression in transfected 293T cell line (H00003397-T01) by ID1 MaxPab polyclonal antibody.

    Lane 1: ID1 transfected lysate(17.05 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3397
  • Gene Name:
  • ID1
  • Gene Alias:
  • ID,bHLHb24
  • Gene Description:
  • inhibitor of DNA binding 1, dominant negative helix-loop-helix protein
  • Gene Summary:
  • The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with members of the basic HLH family of transcription factors. The encoded protein has no DNA binding activity and therefore can inhibit the DNA binding and transcriptional activation ability of basic HLH proteins with which it interacts. This protein may play a role in cell growth, senescence, and differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • DNA-binding protein inhibitor ID-1,OTTHUMP00000030534,OTTHUMP00000030535,dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein),inhibitor of DNA binding 1,inhibitor of differentiation 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook