Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ICT1 polyclonal antibody (A01)

  • Catalog # : H00003396-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ICT1.
  • Immunogen:
  • ICT1 (NP_001536, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003396-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3396
  • Gene Name:
  • ICT1
  • Gene Alias:
  • DS-1
  • Gene Description:
  • immature colon carcinoma transcript 1
  • Gene Summary:
  • The adult colon epithelium contains 3 differentiated cell types that arise from a multipotent stem cell. Deviation from the normal maturation pathway by neoplastic transformation is thought to initiate in stem cells or their early descendants. One potential marker is ICT1 whose mRNA and protein were more highly expressed in undifferentiated than in differentiated cells. [provided by RefSeq
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook