Product Browser

Last updated: 2016/12/11
  • Related Product Showcase
  • By Disease

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ICA1 polyclonal antibody (A01)

  • Catalog # : H00003382-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ICA1.
  • Immunogen:
  • ICA1 (NP_071682, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQAFIKATGKKEDEHVVASDADLDAKLELFHSIQRTCLDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003382-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3382
  • Gene Name:
  • ICA1
  • Gene Alias:
  • ICA69,ICAp69
  • Gene Description:
  • islet cell autoantigen 1, 69kDa
  • Gene Summary:
  • This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
  • Other Designations:
  • diabetes mellitus type I autoantigen,islet cell autoantigen 1,islet cell autoantigen 1 (69kD),islet cell autoantigen 1 isoform,islet cell autoantigen p69
  • RSS
  • YouTube
  • Linkedin
  • Facebook