Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IAPP (Human) Recombinant Protein (P01)

  • Catalog # : H00003375-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IAPP full-length ORF ( NP_000406.1, 1 a.a. - 89 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.2
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003375-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3375
  • Gene Name:
  • IAPP
  • Gene Alias:
  • AMYLIN,DAP,IAP
  • Gene Description:
  • islet amyloid polypeptide
  • Gene Summary:
  • Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer's disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes. [provided by RefSeq
  • Other Designations:
  • Islet amyloid polypeptide (diabetes-associated peptide; amylin)
  • RSS
  • YouTube
  • Linkedin
  • Facebook