Product Browser

Last updated: 2017/10/22
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IAPP purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00003375-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human IAPP protein.
  • Immunogen:
  • IAPP (NP_000406.1, 1 a.a. ~ 89 a.a) full-length human protein.
  • Sequence:
  • MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian tissue lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Gene Information
  • Entrez GeneID:
  • 3375
  • Gene Name:
  • IAPP
  • Gene Alias:
  • AMYLIN,DAP,IAP
  • Gene Description:
  • islet amyloid polypeptide
  • Gene Summary:
  • Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer's disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes. [provided by RefSeq
  • Other Designations:
  • Islet amyloid polypeptide (diabetes-associated peptide; amylin)
  • RSS
  • YouTube
  • Linkedin
  • Facebook