HYAL1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human HYAL1 protein.
Immunogen
HYAL1 (NP_695015.1, 1 a.a. ~ 253 a.a) full-length human protein.
Sequence
MAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HYAL1 MaxPab polyclonal antibody. Western Blot analysis of HYAL1 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of HYAL1 expression in transfected 293T cell line (H00003373-T01) by HYAL1 MaxPab polyclonal antibody.
Lane 1: HYAL1 transfected lysate(27.83 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HYAL1
Entrez GeneID
3373GeneBank Accession#
NM_153283.1Protein Accession#
NP_695015.1Gene Name
HYAL1
Gene Alias
HYAL-1, LUCA1, MGC45987, NAT6
Gene Description
hyaluronoglucosaminidase 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a lysosomal hyaluronidase. Hyaluronidases intracellularly degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. Hyaluronan is thought to be involved in cell proliferation, migration and differentiation. This enzyme is active at an acidic pH and is the major hyaluronidase in plasma. Mutations in this gene are associated with mucopolysaccharidosis type IX, or hyaluronidase deficiency. The gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
hyaluronidase 1|plasma hyaluronidase|tumor suppressor LUCA-1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Increased hyaluronic acid content in idiopathic pulmonary arterial hypertension.
Papakonstantinou E, Kouri FM, Karakiulakis G, Klagas I, Eickelberg O.
The European Respiratory Journal 2008 Sep; 32(6):1504.
-
Increased hyaluronic acid content in idiopathic pulmonary arterial hypertension.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com