Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HTR5A (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00003361-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HTR5A full-length ORF (NP_076917.1) recombinant protein without tag.
  • Sequence:
  • MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 40.3
  • Form:
  • Liquid
  • Recommend Usage:
  • Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 3361
  • Gene Name:
  • HTR5A
  • Gene Alias:
  • 5-HT5A,MGC138226
  • Gene Description:
  • 5-hydroxytryptamine (serotonin) receptor 5A
  • Gene Summary:
  • The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. [provided by RefSeq
  • Other Designations:
  • 5-hydroxytryptamine receptor 5A
  • RSS
  • YouTube
  • Linkedin
  • Facebook