HTR2C (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HTR2C partial ORF ( NP_000859, 1 a.a. - 52 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
31.46
Interspecies Antigen Sequence
Mouse (81); Rat (81)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HTR2C
Entrez GeneID
3358GeneBank Accession#
NM_000868Protein Accession#
NP_000859Gene Name
HTR2C
Gene Alias
5-HT2C, 5-HTR2C, HTR1C
Gene Description
5-hydroxytryptamine (serotonin) receptor 2C
Omim ID
312861Gene Ontology
HyperlinkGene Summary
Serotonin (5-hydroxytryptamine, 5-HT), a neurotransmitter, elicits a wide array of physiological effects by binding to several receptor subtypes, including the 5-HT2 family of seven-transmembrane-spanning, G-protein-coupled receptors, which activate phospholipase C and D signaling pathways. This gene encodes the 2C subtype of serotonin receptor and its mRNA is subject to multiple RNA editing events, where genomically encoded adenosine residues are converted to inosines. RNA editing is predicted to alter amino acids within the second intracellular loop of the 5-HT2C receptor and generate receptor isoforms that differ in their ability to interact with G proteins and the activation of phospholipase C and D signaling cascades, thus modulating serotonergic neurotransmission in the central nervous system. Studies in humans have reported abnormalities in patterns of 5-HT2C editing in depressed suicide victims. [provided by RefSeq
Other Designations
5-hydroxytryptamine receptor 2C|OTTHUMP00000023868|OTTHUMP00000023869|serotonin 5-HT-2C receptor|serotonin receptor 2C
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com