Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HTR2C polyclonal antibody (A01)

  • Catalog # : H00003358-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HTR2C.
  • Immunogen:
  • HTR2C (NP_000859, 1 a.a. ~ 52 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPDGV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003358-A01
    Western Blot detection against Immunogen (31.83 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3358
  • Gene Name:
  • HTR2C
  • Gene Alias:
  • 5-HT2C,5-HTR2C,HTR1C
  • Gene Description:
  • 5-hydroxytryptamine (serotonin) receptor 2C
  • Gene Summary:
  • Serotonin (5-hydroxytryptamine, 5-HT), a neurotransmitter, elicits a wide array of physiological effects by binding to several receptor subtypes, including the 5-HT2 family of seven-transmembrane-spanning, G-protein-coupled receptors, which activate phospholipase C and D signaling pathways. This gene encodes the 2C subtype of serotonin receptor and its mRNA is subject to multiple RNA editing events, where genomically encoded adenosine residues are converted to inosines. RNA editing is predicted to alter amino acids within the second intracellular loop of the 5-HT2C receptor and generate receptor isoforms that differ in their ability to interact with G proteins and the activation of phospholipase C and D signaling cascades, thus modulating serotonergic neurotransmission in the central nervous system. Studies in humans have reported abnormalities in patterns of 5-HT2C editing in depressed suicide victims. [provided by RefSeq
  • Other Designations:
  • 5-hydroxytryptamine receptor 2C,OTTHUMP00000023868,OTTHUMP00000023869,serotonin 5-HT-2C receptor,serotonin receptor 2C
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook