Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HTR1B (Human) Recombinant Protein (Q01)

  • Catalog # : H00003351-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HTR1B partial ORF ( NP_000854, 1 a.a. - 49 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.13
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003351-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3351
  • Gene Name:
  • HTR1B
  • Gene Alias:
  • 5-HT1B,5-HT1DB,HTR1D2,HTR1DB,S12
  • Gene Description:
  • 5-hydroxytryptamine (serotonin) receptor 1B
  • Gene Summary:
  • The neurotransmitter serotonin (5-hydroxytryptamine; 5-HT) exerts a wide variety of physiologic functions through a multiplicity of receptors and may be involved in human neuropsychiatric disorders such as anxiety, depression, or migraine. These receptors consist of 4 main groups, 5-HT-1, 5-HT-2, 5-HT-3, and 5-HT4, subdivided into several distinct subtypes on the basis of their pharmacologic characteristics, coupling to intracellular second messengers, and distribution within the nervous system (Zifa and Fillion, 1992 [PubMed 1359584]). The serotonergic receptors belong to the multigene family of receptors coupled to guanine nucleotide-binding proteins.[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000016769
  • RSS
  • YouTube
  • Linkedin
  • Facebook