Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSPG2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003339-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HSPG2 partial ORF ( NP_005520.3, 25 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSISGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003339-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3339
  • Gene Name:
  • HSPG2
  • Gene Alias:
  • PLC,PRCAN,SJA,SJS,SJS1
  • Gene Description:
  • heparan sulfate proteoglycan 2
  • Gene Summary:
  • Heparan sulfate proteoglycan is a major component of basement membranes, where the molecule may be involved in the stabilization of other molecules as well as being involved with glomerular permeability to macromolecules and cell adhesion. This form of HSPG, known as HSPG2 or perlecan, is encoded by a gene that maps to chromosome 1. The gene for the form of HSPG associated with the cell surface of fibroblasts has been mapped to human chromosome 8 (MIM 142460).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000002765,Schwartz-Jampel syndrome 1 (chondrodystrophic myotonia),endorepellin (domain V region),heparan sulfate proteoglycan of basement membrane,perlecan proteoglycan
  • RSS
  • YouTube
  • Linkedin
  • Facebook