Product Browser

Last updated: 2017/8/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSPG2 polyclonal antibody (A01)

  • Catalog # : H00003339-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HSPG2.
  • Immunogen:
  • HSPG2 (NP_005520.3, 25 a.a. ~ 134 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDMLADSISGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLESEYLKIPGDQVVSV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003339-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3339
  • Gene Name:
  • HSPG2
  • Gene Alias:
  • PLC,PRCAN,SJA,SJS,SJS1
  • Gene Description:
  • heparan sulfate proteoglycan 2
  • Gene Summary:
  • Heparan sulfate proteoglycan is a major component of basement membranes, where the molecule may be involved in the stabilization of other molecules as well as being involved with glomerular permeability to macromolecules and cell adhesion. This form of HSPG, known as HSPG2 or perlecan, is encoded by a gene that maps to chromosome 1. The gene for the form of HSPG associated with the cell surface of fibroblasts has been mapped to human chromosome 8 (MIM 142460).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000002765,Schwartz-Jampel syndrome 1 (chondrodystrophic myotonia),endorepellin (domain V region),heparan sulfate proteoglycan of basement membrane,perlecan proteoglycan
  • RSS
  • YouTube
  • Linkedin
  • Facebook